TESAMORELIN 5MG

$32.00

Technical Specifications
CAS Number: 901758-09-6
Molecular Formula: C221H366N72O67S
Molecular Weight: 5135.9 g/mol
Sequence (Single-Letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (with N-terminal trans-3-hexenoyl group)
Purity: ≥ 99.0% (Batch-Verified by RP-HPLC; Third-Party COA Included)
Format: Sterile-filtered, white lyophilized powder

Batch-verified at 99% purity with an official third-party COA included.

Availability: In stock

 
5 items
$28.80 for each product
(Save 10%)
10 items
$27.20 for each product
(Save 15%)
-
+

Tesamorelin is a synthetic peptide consisting of 44 amino acids modified with a trans-3-hexenoic acid group. It functions as a potent Growth Hormone-Releasing Hormone (GHRH) analogue, designed to stimulate the synthesis and pulsatile secretion of endogenous growth hormone by targeting the anterior pituitary gland.

Widely utilized in metabolic research, Tesamorelin is primarily investigated for its highly targeted lipolytic (fat-breaking) effects. In preclinical studies, it has demonstrated a distinct ability to significantly reduce visceral adipose tissue (deep abdominal fat) while favorably altering lipid profiles and metabolic biomarkers without disrupting glucose homeostasis.

Core Research Areas

  • Visceral Adiposity: Extensively studied for its targeted reduction of deep abdominal fat layers.

  • HGH Secretion: Stimulates natural, pulsatile release of Growth Hormone via GHRH pathway activation.

  • Lipid Modulation: Investigated for its capacity to improve systemic triglyceride and cholesterol levels.

Storage & Handling

  • Lyophilized: Stable at room temp for up to 3 weeks. Store long-term desiccated below -18°C.

Laboratory Research Disclaimer: This product is synthesized and distributed exclusively for laboratory research use and in vitro testing. It is not approved for human consumption, therapeutic use, or clinical application.

Reviews

There are no reviews yet.

Be the first to review “TESAMORELIN 5MG”

Your email address will not be published. Required fields are marked *

Shopping Cart
Scroll to Top